PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0184s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family Trihelix
Protein Properties Length: 354aa    MW: 39390.9 Da    PI: 8.8226
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0184s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.18.4e-2742122286
             trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          W ++e++aLi++r+em++ ++++k++k+lWe++s km+erg+ers+++C++kw+nl k+ykk k+++++++++    ++ +++le
  Mapoly0184s0008.1.p  42 WVQDEIKALIALRKEMDTLFNTSKSNKHLWEQISTKMKERGYERSATMCTDKWRNLLKEYKKAKHQDRGGSAK----VACYKDLE 122
                          ********************************************************************98443....45677776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-433104IPR009057Homeodomain-like
PROSITE profilePS500908.3163498IPR017877Myb-like domain
SMARTSM007171.1E-538100IPR001005SANT/Myb domain
CDDcd122031.36E-2940105No hitNo description
PfamPF138372.9E-2041124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEVVSNAVPP QQLQPSPQQL ILSDPPADES EIKTPKKRAE TWVQDEIKAL IALRKEMDTL  60
FNTSKSNKHL WEQISTKMKE RGYERSATMC TDKWRNLLKE YKKAKHQDRG GSAKVACYKD  120
LEELLGDRAK AQIPLKSPPP LNKLEPIASP GKVPIRAALN LERRLDHDGH PAAIPSTDGM  180
VHTSMVVANG ITPPQQYWRD ANANGGERRP AAPAGGKVIV VKCGDVVRRV RIDGPFESIK  240
ESLKTAFGLR SKRAFWLEDD EGVVQTLSRD MPPGEYTLNL DPGITVKICV YDTSDRLTGS  300
TESKTLYTEE EFREFLTRRG WSGLREVGGF RDIDSLEELR TGAVYQRAGV IGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A2e-3936120186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00640PBMTransfer from MDP0000164819Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248872.11e-135PREDICTED: trihelix transcription factor GT-1-like
SwissprotQ9FX531e-120TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D6QVI31e-135A0A0D6QVI3_ARACU; Uncharacterized protein
STRINGVIT_01s0010g02420.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59331318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-102Trihelix family protein